General Information

  • ID:  hor002822
  • Uniprot ID:  P20481
  • Protein name:  Buccalin-S
  • Gene name:  NA
  • Organism:  Aplysia californica (California sea hare)
  • Family:  NA
  • Source:  Animal
  • Expression:  Cholinergic motor neuron B15 innervating buccal muscles in Aplysia.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Aplysia (genus), Aplysiidae (family), Aplysioidea (superfamily), Aplysiida (order), Tectipleura, Euthyneura, Heterobranchia (subclass), Gastropoda (class), Mollusca (phylum), Lophotrochozoa, Spiralia, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  QLDPMLFSGRL
  • Length:  11(465-475)
  • Propeptide:  MAHHRGHRHILLYVSLALSLGLALAEDATDPSDDTGSFDDVEAVSEEADLDPYSMSQELNKRPNVDPYSYLPSVGKRAFDHYGFTGGLGKRKIDHFGFVGGLGKRQIDPLGFSGGIGKRYDSFAYSAGLGKRGMDSLAFSGGLGKRGMDSLAFSGGLGKRGMDSLAFSGGLGKRGMDSLAFSGGLGKRGMDSLAFSGGLGKRGMDSLAFSGGLGKRGMDSFTFAPGLGKRGMDSLAFAGGLGKRMDGFAFAPGLG
  • Signal peptide:  MAHHRGHRHILLYVSLALSLGLALA
  • Modification:  T1 Pyrrolidone carboxylic acid;T11 Leucine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Acting presynaptically on nerve terminals to inhibit acetylcholine release
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P20481-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor002822_AF2.pdbhor002822_ESM.pdb

Physical Information

Mass: 145507 Formula: C57H93N15O16S
Absent amino acids: ACEHIKNTVWY Common amino acids: L
pI: 6.34 Basic residues: 1
Polar residues: 2 Hydrophobic residues: 4
Hydrophobicity: 16.36 Boman Index: -1155
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 106.36
Instability Index: 223.64 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  8101868
  • Title:  The Buccalin-Related Neuropeptides: Isolation and Characterization of an Aplysia cDNA Clone Encoding a Family of Peptide Cotransmitters